PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_003001-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 259aa    MW: 30090.1 Da    PI: 5.6469
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_003001-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.47.8e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l + +   G ++W+++++  g+ R++k+c++rw +yl
    NNU_003001-RA 14 RGPWTIEEDHKLMNFILNNGIRCWRLVPKLAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding51.52.3e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ ++ E++++++++ +lG++ W++Ia++++ gRt++++k++w++
    NNU_003001-RA  67 RGALSEMEEDQIIQLHSRLGNR-WSKIAAHFP-GRTDNEIKNYWNT 110
                      78889*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-20564IPR009057Homeodomain-like
PROSITE profilePS5129414.812961IPR017930Myb domain
SuperFamilySSF466891.5E-2711108IPR009057Homeodomain-like
SMARTSM007178.5E-71363IPR001005SANT/Myb domain
PfamPF002494.0E-121461IPR001005SANT/Myb domain
CDDcd001675.97E-51661No hitNo description
PROSITE profilePS5129424.50862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2465116IPR009057Homeodomain-like
SMARTSM007172.8E-1566114IPR001005SANT/Myb domain
PfamPF002496.2E-1567110IPR001005SANT/Myb domain
CDDcd001671.22E-1071110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MGRKPCCEKI GLKRGPWTIE EDHKLMNFIL NNGIRCWRLV PKLAGLLRCG KSCRLRWINY  60
LRPDLKRGAL SEMEEDQIIQ LHSRLGNRWS KIAAHFPGRT DNEIKNYWNT RIKKRLKLQG  120
LDPVTHKPIE QEKDEGLKIE PLDTRRFQEI PAVPQKELQE NCRSDSDETV DLLHDYEMLW  180
EELDMGLSSD NPEICSLTKY YSPSISLEVS FNPSCSTGES SSLQEDSGQC WINNVENSVP  240
PSWDGLHDVE DIFHFENHQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-27121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010248826.10.0PREDICTED: myb-related protein 315-like
SwissprotP813946e-78MYB15_ANTMA; Myb-related protein 315
TrEMBLF6GX581e-100F6GX58_VITVI; Putative uncharacterized protein
STRINGVIT_14s0219g00050.t012e-99(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.13e-80myb domain protein 40